Protein Info for Shew_3533 in Shewanella loihica PV-4

Annotation: glyoxalase/bleomycin resistance protein/dioxygenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF00903: Glyoxalase" amino acids 15 to 122 (108 residues), 30.1 bits, see alignment E=5.6e-11 amino acids 144 to 248 (105 residues), 40.5 bits, see alignment E=3.4e-14 PF18029: Glyoxalase_6" amino acids 16 to 124 (109 residues), 27.4 bits, see alignment E=4.5e-10 amino acids 149 to 253 (105 residues), 28.2 bits, see alignment E=2.6e-10

Best Hits

KEGG orthology group: K06996, (no description) (inferred from 100% identity to slo:Shew_3533)

Predicted SEED Role

"27 kDa antigen Cfp30B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIV1 at UniProt or InterPro

Protein Sequence (259 amino acids)

>Shew_3533 glyoxalase/bleomycin resistance protein/dioxygenase (RefSeq) (Shewanella loihica PV-4)
MKITSYQHGDPCWIELASHEAASGKHFYSALFDWQLKDMPIPDGVYTMFAIEDDDIGAMY
QLPQNMIDDKVPTHWSIYFAVDDLEASLEAVIANGGQVILGPHSVGDAGKMAQCLDPEGA
SFSLWQAGAHIGSMRMGEANTLCWAELCCRDTAKAQAFYTKVMGWQVRESQMEDFTYYEW
LQGERAVGGMMAMTEEWGDMPPHWMPYIMVDNCDATVAKATEIGGQVCVPPTDIPEVGRF
SVINDPQGGTLSVIRLNMT