Protein Info for Shew_3529 in Shewanella loihica PV-4

Annotation: azoreductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 PF03358: FMN_red" amino acids 3 to 165 (163 residues), 60.1 bits, see alignment E=2e-20 PF02525: Flavodoxin_2" amino acids 3 to 194 (192 residues), 185 bits, see alignment E=1.4e-58

Best Hits

Swiss-Prot: 100% identical to AZOR_SHELP: FMN-dependent NADH-azoreductase (azoR) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K01118, FMN-dependent NADH-azoreductase [EC: 1.7.-.-] (inferred from 100% identity to slo:Shew_3529)

MetaCyc: 61% identical to FMN dependent NADH:quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
RXN0-5375 [EC: 1.7.1.17]; 1.6.5.- [EC: 1.7.1.17]

Predicted SEED Role

"FMN-dependent NADH-azoreductase"

Isozymes

Compare fitness of predicted isozymes for: 1.7.-.-

Use Curated BLAST to search for 1.7.-.- or 1.7.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIU7 at UniProt or InterPro

Protein Sequence (197 amino acids)

>Shew_3529 azoreductase (RefSeq) (Shewanella loihica PV-4)
MAKVLVLKSSILGDYSQSAKLIDHLQQHWQGQGAEVTVRDLAAQPLPVLDGEIAMGLRGG
DELSPRQQEVLALSDELVAELKAHDTLVIAAPMYNFSIPTQLKNWIDLVARAGVTFTYTE
TGPKGLVEGKRAVLVTTRGGVHKNGASDHVVPYLKTVLGFIGIDEVETVYGEALNMGPEA
NEQGISQAKQSIEQLVA