Protein Info for Shew_3519 in Shewanella loihica PV-4

Annotation: outer membrane lipoprotein carrier protein LolA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 47 (47 residues), see Phobius details PF19574: LolA_3" amino acids 64 to 212 (149 residues), 33.3 bits, see alignment E=3.2e-12 PF03548: LolA" amino acids 76 to 239 (164 residues), 31.3 bits, see alignment E=1.7e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3519)

Predicted SEED Role

"FIG027190: Putative transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIT7 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Shew_3519 outer membrane lipoprotein carrier protein LolA (RefSeq) (Shewanella loihica PV-4)
MMTPWFHRITWLHRITCLHRTAKAGLFCLLFCPMFCLSLVSFVTLAEQSTDYEALFKAPA
DNAALSKLVTRLGGGESARGAFTQSRYLKVLKKPLVSRGEFLFQDKLGIAWLQTAPFPSG
LVLTQNTLVQIDADGNRQISHADDNPQAGAMAQMMPKLMSALLGGDLAPLEAQFTLHLQQ
QAECWQLGLEPIDPLIKQAMPRIVLQGSEQLESLSLLDNRGDLSVIEFNALAQRPLTADE
QAYFKLDADPRPATEAR