Protein Info for Shew_3512 in Shewanella loihica PV-4

Annotation: acyl carrier protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 82 PF00550: PP-binding" amino acids 11 to 76 (66 residues), 47.3 bits, see alignment E=1e-16

Best Hits

Swiss-Prot: 56% identical to ACP2_RALSO: Acyl carrier protein 2 (acpP2) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02078, acyl carrier protein (inferred from 100% identity to slo:Shew_3512)

Predicted SEED Role

"Acyl carrier protein (ACP2)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIT0 at UniProt or InterPro

Protein Sequence (82 amino acids)

>Shew_3512 acyl carrier protein (RefSeq) (Shewanella loihica PV-4)
MQNREQILQMLTQILVDEFEIDADDITPEASLYQELDLDSIDAVDLVIKLQQLTGKKIQP
DEFKAVRTVDDVVTAIEGLVKQ