Protein Info for Shew_3474 in Shewanella loihica PV-4

Annotation: ATP-dependent DNA helicase RecQ (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 transmembrane" amino acids 60 to 81 (22 residues), see Phobius details TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 19 to 466 (448 residues), 606.6 bits, see alignment E=3.1e-186 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 19 to 605 (587 residues), 808.9 bits, see alignment E=2.5e-247 PF04851: ResIII" amino acids 29 to 187 (159 residues), 25.3 bits, see alignment E=3.9e-09 PF00270: DEAD" amino acids 32 to 190 (159 residues), 92.6 bits, see alignment E=7.1e-30 PF00271: Helicase_C" amino acids 227 to 333 (107 residues), 81.6 bits, see alignment E=1.5e-26 PF16124: RecQ_Zn_bind" amino acids 344 to 406 (63 residues), 71.8 bits, see alignment E=1.9e-23 PF09382: RQC" amino acids 408 to 516 (109 residues), 123 bits, see alignment E=1.6e-39 PF00570: HRDC" amino acids 537 to 603 (67 residues), 77.3 bits, see alignment E=2.1e-25

Best Hits

Swiss-Prot: 55% identical to RECQ_HAEIN: ATP-dependent DNA helicase RecQ (recQ) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 100% identity to slo:Shew_3474)

MetaCyc: 60% identical to ATP-dependent DNA helicase RecQ (Escherichia coli K-12 substr. MG1655)
RXN-11135 [EC: 5.6.2.4]

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12 or 5.6.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIP2 at UniProt or InterPro

Protein Sequence (610 amino acids)

>Shew_3474 ATP-dependent DNA helicase RecQ (RefSeq) (Shewanella loihica PV-4)
MDLALTSPDVTDSDPLAACLQTVFGYRTFRTGQREVIEQVCGGQDALVIMPTGGGKSLCY
QLPALVLHGLTLVVSPLISLMKDQVDSLKQMGVAAAYLNSSQSREEALTIYRQLHNGELK
LLYVSPERLLTDSFIERLHNLPLSLFAIDEAHCISQWGHDFRPEYAALGQLKQLFPRVPM
MALTATADKATREDICQRLGIAPFELLTSFDRPNIRYTVAEKLNAANQLRQFIQAQNGNS
GIIYCSSRRRVDEVAERLRMQGYHADAYHAGKTQEERADIQERFLKDQLDIVVATVAFGM
GINKSNVRFVVHYDIPKSVEAYYQETGRAGRDGLDAEAFMLFDPADIGRVRHLIEQQEPG
PQQQVEYHKLNTMAAFAEAQTCRRQVLLHYFDESASEPCGNCDICLDPPKRYDGVEDAQK
VLSCIFRLQQKFGVNHLIEVLRGSKAASVVDRGHDKLSTWGIGKEKSHEFWLSIIRQIIH
LGFASQDITRGSAIKLNPQARAVLKGELPLQLAEPRISITTHVKRRSSSRAPINYDRKLF
ARLKQLRRSLAEELDVPPYLVFNDATLAEMAAMLPTSPGEMLAVNGVGETKLNRFGGEFL
DEINDYLTRS