Protein Info for Shew_3468 in Shewanella loihica PV-4

Annotation: membrane protein involved in aromatic hydrocarbon degradation (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF03349: Toluene_X" amino acids 20 to 450 (431 residues), 431.1 bits, see alignment E=1.8e-133

Best Hits

KEGG orthology group: K06076, long-chain fatty acid transport protein (inferred from 100% identity to slo:Shew_3468)

Predicted SEED Role

"Long-chain fatty acid transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIN6 at UniProt or InterPro

Protein Sequence (451 amino acids)

>Shew_3468 membrane protein involved in aromatic hydrocarbon degradation (RefSeq) (Shewanella loihica PV-4)
MMKKHILSLAVVAAIATPLSQVQAAGFQLAEYSATGLGRAFAGEAAMADNAAAQARNPAM
LTYLEGRQLSLGGIYVMPNVDVEGDVTLASPVLGPQGVTMNADALDVADDALVPNFYYSN
QLNDQWTWGLAVNSNYGLATEVPSTHPTAIFGKETSVTTVEFNPNLAYKVSEAVSVGAGL
RIVYGEGKIGASTPAWVDGIKAIPTLPAEIAGALPPGGTSLKSMEGDDIGYGWQLGASWQ
INPAHRIGLAYHSGVELELDGHASGLIYNGGQDVEIEGYMPLELPAFAELASYHQLTDNW
AMHASINWTQWSVFDQLVAYFPGEQKPVGGLESDLVKVENFKDNWRFALGTSYQLSDKWL
VRGGVALDKTAVEDEYRTITIPDSDRLWFSAGAGYQASKNLTLDFAVTYIKAHGDAPINE
TMNLMNLAQVSFNGEAGGDVWLLGAQLSYKM