Protein Info for Shew_3464 in Shewanella loihica PV-4

Annotation: ferredoxin (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details PF03929: PepSY_TM" amino acids 10 to 250 (241 residues), 35.3 bits, see alignment E=1.2e-12 PF00111: Fer2" amino acids 277 to 338 (62 residues), 36.6 bits, see alignment E=3.6e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3464)

Predicted SEED Role

"Ferredoxin" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIN2 at UniProt or InterPro

Protein Sequence (375 amino acids)

>Shew_3464 ferredoxin (RefSeq) (Shewanella loihica PV-4)
MRLSIISARSLHRILGLIVGAQLLIWTLTGLAFNLIDDQLLDANVMRTKPGKEQQNSVRL
IQPTVTLAEIMAEMTNQQTNSAYQQIDLKRVELAALLERPVYRLRTSAGTLAFWGDTGEA
VNLDNEQLIRLARQSYLGEVRLSSPIVDKEAAQRYGGNPAFYRFDTQDKLGTQIFIDGQS
GQVKAHENQGSRFKQLLFMLHFIDYFPNNGVSFNHLATQLIAFAALLLGLSGAWVLVRKL
AAGDYFSWQVNRSADKGKRQLTLLSPDGEPLESLILAPGNLLDNLNHDRTRIPSQCGGGG
QCGMCRVRFLEQAPQATVEEQTRLKQEHLALGIRLSCQHNCHQGKIALTSRAQLRFWQKA
QSDAEQAVRPAQASS