Protein Info for Shew_3457 in Shewanella loihica PV-4

Annotation: UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate--D-alanyl-D-alanyl ligase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01225: Mur_ligase
  • amino acids 25 to 82 (58 residues), 22.6 bits, 1.6e-08
• TIGR01143: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  • amino acids 30 to 446 (417 residues), 458 bits, E=1.6e-141
• PF08245: Mur_ligase_M
  • amino acids 106 to 292 (187 residues), 164.5 bits, E=4.9e-52
• PF02875: Mur_ligase_C
  • amino acids 316 to 435 (120 residues), 50.2 bits, E=7.4e-17

Best Hits

KEGG orthology group: K01929, UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase [EC: 6.3.2.10] (inferred from 100% identity to slo:Shew_3457)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase (EC 6.3.2.10)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.10)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• Lysine biosynthesis
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.10

Sequence Analysis Tools

See A3QIM5 at UniProt or InterPro

Protein Sequence (456 amino acids)

>Shew_3457 UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate--D-alanyl-D-alanyl ligase (RefSeq) (Shewanella loihica PV-4)
MIPLKLSELAKVLNAKHIGDDLSVSKVSSDSRVVDAQTLFVALKGERFDAHDFAAKAVMD
GASALLVERELPIAAPQLIVANSQKAMGQIGAHVKQCVAPKSVALTGSNGKTSVKEMVAT
ILSTQHQVLYTAGNFNNEVGVPLTLLRLEPQHEYGVFELGANHLGEINYTSSLVQPDVAM
VNNVASAHLEGFGSLEGVAKAKSEIFLHLAKDGVAVINADDAFADVMRRAAASHTQLSFS
SQGNPADVSADELSADALGCYRFRIAYLDEQRTVSLPLSGRHQVSNALAATSICLALGLS
LDEIVQGLMRLQPVKGRMQPTRLGRFLLIDDTYNANPASVGAAIDWLQEIEGNRCLVLGD
LGELGDNASLLHRQLGEKAKQQGIDALYSLGELSRASSEAFAGKHFTDLDALVVDLVSYF
NQLTGKVTVLVKGSRSARMERVVEALIAAFERKELF