Protein Info for Shew_3453 in Shewanella loihica PV-4

Annotation: UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01133: undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase" amino acids 3 to 353 (351 residues), 362.5 bits, see alignment E=1.1e-112 PF03033: Glyco_transf_28" amino acids 7 to 144 (138 residues), 160.2 bits, see alignment E=6.8e-51 PF13439: Glyco_transf_4" amino acids 21 to 137 (117 residues), 30.3 bits, see alignment E=8.4e-11 PF13579: Glyco_trans_4_4" amino acids 21 to 143 (123 residues), 33.3 bits, see alignment E=1.2e-11 PF04101: Glyco_tran_28_C" amino acids 184 to 349 (166 residues), 141.1 bits, see alignment E=7.4e-45

Best Hits

Swiss-Prot: 100% identical to MURG_SHELP: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (murG) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K02563, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC: 2.4.1.227] (inferred from 100% identity to slo:Shew_3453)

MetaCyc: 56% identical to N-acetylglucosaminyl transferase (Escherichia coli K-12 substr. MG1655)
acetylglucosaminyltransferase. [EC: 2.4.1.227]

Predicted SEED Role

"UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227)" in subsystem Peptidoglycan Biosynthesis (EC 2.4.1.227)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.227

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIM1 at UniProt or InterPro

Protein Sequence (364 amino acids)

>Shew_3453 UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (RefSeq) (Shewanella loihica PV-4)
MASEKRILIMAGGTGGHVFPALAVAKALAKQGWQVRWLGTADRMEARLVPQHGFDIDFID
IKGVRGNGLIRKLAAPFKILRSIMQAREVIKEFKPHVVLGMGGFASGPGGVAAKLSGIPL
VLHEQNAIPGMTNKLLSRIASRVLCAFENTFEGNAEVVGNPIRSELIALGRSEQPIVPDD
ALRVLVVGGSLGAKIFNDLMPSVTAAVAQHHSMTVWHQVGKGNQAQVEAEYLQLGQSGSV
KVAEFIDDMEAAYRWADVILCRAGALTVSEVAAVGLPSLLVPYPHAVDDHQTKNAQVLVE
AGGAFLLPQTVLDSEKLISKLQILASDRKALIEMGQLAKSVAVLDATERVAAVCIALASK
EKDD