Protein Info for Shew_3430 in Shewanella loihica PV-4

Annotation: pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 6 to 76 (71 residues), 61.8 bits, E=1.6e-20
  • amino acids 117 to 187 (71 residues), 65.2 bits, E=1.3e-21
  • amino acids 221 to 293 (73 residues), 70.1 bits, E=4e-23
• TIGR01348: dihydrolipoyllysine-residue acetyltransferase
  • amino acids 197 to 650 (454 residues), 662.2 bits, E=3.7e-203
• PF13533: Biotin_lipoyl_2
  • amino acids 264 to 296 (33 residues), 27.1 bits, see alignment (E = 9.9e-10)
• PF02817: E3_binding
  • amino acids 344 to 379 (36 residues), 64.8 bits, 2.2e-21
• PF00198: 2-oxoacid_dh
  • amino acids 419 to 649 (231 residues), 273.4 bits, E=5.4e-85

Best Hits

Swiss-Prot: 50% identical to ODP2_AZOVI: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex from Azotobacter vinelandii

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 100% identity to slo:Shew_3430)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 2.3.1.12)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• pyruvate fermentation to acetate V (2/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.12

Sequence Analysis Tools

See A3QIJ8 at UniProt or InterPro

Protein Sequence (650 amino acids)

>Shew_3430 pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (RefSeq) (Shewanella loihica PV-4)
MAELKEVLVPDIGGDEVQVIEICAAVGDTLAAEESIITVESDKATMDIPAPFAGKLAEIK
VAVGDTVSEGTLIAMMEAGEAQAAEPAPAESAPVAAPAAPAPAAPVASAPASAQVIEVTV
PDIGDASDVDVIEVLVAVGDSINVDTGLITLETDKATMEVPAPAAGVVKEMKVAVGDKVS
QGSLVLMLEVSGGEAAAPAASAAPAPSAEAAPAAAASIEVKEISVPDIGDASDVDVIEVL
VAAGDVIEADQGLITLETDKATMEVPAPFAGKLVSVTVKVGDKVSQGSVIATIETQSSAP
VAAPAPAAAAPAPVAQASAPAPAASKPPVPHHPSAGSKPVTGAVHASPAVRRLAREFGAD
LTQVTGTGPKGRILKEDVQAFIKYELSRPKASAATSVGAGEGGLQVIAAPKVDFAKFGEV
EEVPLSRIQKISGPNLHRNWVTIPHVTQFDEADITEMEAFRKQQNEIAAKQKTGVKITPL
VFMMKAVAKTLQQFPVFNASLSADGESLIKKKYYHIGVAVDTPNGLVVPVVRDVDKKGII
ELSAELMEISVKARDGKLKAADMQGSCFTISSLGGIGGTAFTPIVNYPDVAILGVSKSEI
KPKWNGKEFEPKLMLPLSLSYDHRVIDGAMAARFSVTLSSMLSDIRTLIL