Protein Info for Shew_3420 in Shewanella loihica PV-4

Annotation: integral membrane sensor signal transduction histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 179 to 200 (22 residues), see Phobius details PF00672: HAMP" amino acids 196 to 250 (55 residues), 27.8 bits, see alignment 3.8e-10 PF00512: HisKA" amino acids 263 to 328 (66 residues), 47.9 bits, see alignment E=1.7e-16 PF02518: HATPase_c" amino acids 378 to 491 (114 residues), 59.9 bits, see alignment E=4.8e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3420)

Predicted SEED Role

"Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-)" in subsystem Potassium homeostasis (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QII8 at UniProt or InterPro

Protein Sequence (493 amino acids)

>Shew_3420 integral membrane sensor signal transduction histidine kinase (RefSeq) (Shewanella loihica PV-4)
MVNSLFGRILLLTSACVLLLFLGFWQWSSLSQQHSQRLVQQSLHRELATHMAEINPLLSQ
GIASDAALKEAFHDLMLLGPSFEIYTLDTQGKVVAFDAREEQIKTHRVDITKIHSFLKGN
TLPILGTDPRSDGQQKIFSASPLTGPNGTLSGYLYVIIGGEAFDSWQSLIQAKDLPERWG
VALGGWALFTLILFALLLRYLTRPLNRLTQALGELEHKPIDQPLALPLAPSRSQEMAQLN
GQINRLLEEVAQKQRQVTAQQAAKQEFLLHLSHDLKTPLTTLLGYLDTWLLSPADARDDS
LLQYAAASGQKLQQLLAQMLELAALENGQIKANMRRVSLQSILDELNQTFTPKAKRAEVS
LRLGQGESEGESEFLYTDPQLMSRVLNNLLDNALRHTPPGGEIAVYPQTLASGSYLVIQD
SGSGMQPEAIAALQHTPSPSQPELYYCRGETLPQLGVGLAIVRQLLARLGCRIEVQSATD
RGSRFMIALPRYR