Protein Info for Shew_3401 in Shewanella loihica PV-4

Annotation: periplasmic copper-binding (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details TIGR04247: nitrous oxide reductase family maturation protein NosD" amino acids 54 to 442 (389 residues), 485.5 bits, see alignment E=7.9e-150 PF13229: Beta_helix" amino acids 99 to 175 (77 residues), 26.5 bits, see alignment E=4.5e-10 amino acids 182 to 291 (110 residues), 53.7 bits, see alignment E=1.9e-18 PF05048: NosD" amino acids 168 to 378 (211 residues), 185.5 bits, see alignment E=9e-59 TIGR03804: parallel beta-helix repeat" amino acids 191 to 225 (35 residues), 25.3 bits, see alignment 9.7e-10 amino acids 207 to 248 (42 residues), 34.8 bits, see alignment 1e-12

Best Hits

KEGG orthology group: K07218, nitrous oxidase accessory protein (inferred from 100% identity to slo:Shew_3401)

Predicted SEED Role

"Nitrous oxide reductase maturation protein NosD" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIG9 at UniProt or InterPro

Protein Sequence (457 amino acids)

>Shew_3401 periplasmic copper-binding (RefSeq) (Shewanella loihica PV-4)
MALRLRLAHGLGLFHQCSLLASSLFRFSLLFFSLLSFSPLSQAAYIEVSPEQDLQQVLDQ
AQMGDNIQLQPGRYLGNFVIKQGIRLIGADDYTSIIDAQGKGNALLLQSSKVTIERLKIV
NWGDDLTAQDAGIYSDQSASELVIRENRLQGDGFGIWLQKGKEIKVHHNRIQGNPGLRSA
DRGNGIQLSIVQNVEVSDNEVNQTRDGIYIISSQHNTIKNNTMHNLRYGIHYMYSHSNRV
QDNLAYDTRAGYALMSSRQLTVSGNESRDSQDYGFLMNFITYSEISHNRIYRVWTKPENK
VLGREGKGLFVYNSAYNSINHNLIDTAEIGIHLTAGSEHTKVFGNSFINNPVQVKYVANR
QAEWSQDGRGNFWSNYLGWDLDNDGFGDRPFEPNDGIDKLIWQYPEAKMLLDSPAVLILR
WIQTQFPVLKPVGVKDSFPLMQAPPLAGQQAVINEAE