Protein Info for Shew_3398 in Shewanella loihica PV-4

Annotation: cytochrome c, class I (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 98 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00034: Cytochrom_C" amino acids 24 to 98 (75 residues), 43.7 bits, see alignment E=5.8e-15 PF13442: Cytochrome_CBB3" amino acids 31 to 93 (63 residues), 31 bits, see alignment E=2.6e-11

Best Hits

Swiss-Prot: 65% identical to CY552_MARHY: Cytochrome c-552 from Marinobacter hydrocarbonoclasticus

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3398)

Predicted SEED Role

"Cytochrome c4" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIG6 at UniProt or InterPro

Protein Sequence (98 amino acids)

>Shew_3398 cytochrome c, class I (RefSeq) (Shewanella loihica PV-4)
MKKIALIAFASLMSLTAHAGDIEAGKAKSMLCAACHGADGISLAPIYPNLKGQKAQYIEK
QLKAFKEGTRQDPVMAPMAMPLTDEDIANLAAYFESLK