Protein Info for Shew_3375 in Shewanella loihica PV-4

Annotation: 2-polyprenylphenol 6-hydroxylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 549 transmembrane" amino acids 499 to 516 (18 residues), see Phobius details amino acids 522 to 540 (19 residues), see Phobius details TIGR01982: 2-polyprenylphenol 6-hydroxylase" amino acids 7 to 442 (436 residues), 549.4 bits, see alignment E=2.5e-169 PF03109: ABC1" amino acids 93 to 342 (250 residues), 244.3 bits, see alignment E=1.1e-76 PF27536: UbiB_N" amino acids 364 to 423 (60 residues), 92.9 bits, see alignment 7.5e-31

Best Hits

Swiss-Prot: 100% identical to UBIB_SHELP: Probable protein kinase UbiB (ubiB) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 100% identity to slo:Shew_3375)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIE3 at UniProt or InterPro

Protein Sequence (549 amino acids)

>Shew_3375 2-polyprenylphenol 6-hydroxylase (RefSeq) (Shewanella loihica PV-4)
MTIKSMRRAYQVVKTVLQYGLDDLIPAKLKPWYFRLLRWSFFWLTNQHKDKVGGERLKLA
MQELGPVYIKFGQMLSTRRDLLSDEWAEELAMLQDRVPPFDSAIARAQIEAELGAPIETY
FDNFDDTPLASASISQVHTATLKSNGEEVVLKVLRPNVEEKVHADLLLMTQSAQVLETLL
GHGNRLRPAEVVEDYRTTIEGELNLKLEALNAIKLRNNFIDSGALYIPKMYEEFCFTRLI
VMERIYGVPVSDRAALEAQGTNLKLLAERGVELFFTQVFRDNFFHADMHPGNIFVSTEHP
EDPFYIGLDCGIMGTLTEQDKRYLAENFLAFFNRDYTRIAQLYIESGWVAADTDLVAFEQ
AIKVVCEPMFNKPLDEISFGHVLLELFRTARRFDMVVQPQLVLLEKTLLYIEGLGRQLYP
QLDLWQTAKPFLESWMAEQMGPLGMAKKIKKQFPYWTDKLPELPELVYDNLKMGKNFVNS
QNQLLDRYLKQQQKAHKSNYLLITSAVLVICGSILFSQNATLWASYACIGIGATLWLLGW
RSRPKNRKF