Protein Info for Shew_3368 in Shewanella loihica PV-4

Annotation: phosphoesterase, PA-phosphatase related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 114 to 140 (27 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details PF01569: PAP2" amino acids 63 to 173 (111 residues), 76.3 bits, see alignment E=1.9e-25 PF14378: PAP2_3" amino acids 107 to 168 (62 residues), 28.1 bits, see alignment E=1.7e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3368)

Predicted SEED Role

"PAP2 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QID6 at UniProt or InterPro

Protein Sequence (176 amino acids)

>Shew_3368 phosphoesterase, PA-phosphatase related (RefSeq) (Shewanella loihica PV-4)
MFQTLAKFDRQAFAAINAYGVAYRLNPKARVISATGDGPYYLYLCVLLLLLDERGETLFN
AALTAFIIELPLYLVLKNSIRRTRPCHQSLPGGDSLMLTFEPSDKFSLPSGHTAAAFVMA
SAIAWCYPTFAWLAFAWATAIGVSRIILGVHYPLDILAGALLGVTSCYLALPLVGQ