Protein Info for Shew_3364 in Shewanella loihica PV-4

Annotation: acetyl-CoA carboxylase, biotin carboxyl carrier protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00531: acetyl-CoA carboxylase, biotin carboxyl carrier protein
  • amino acids 1 to 143 (143 residues), 139.6 bits, E=5.9e-45
• PF00364: Biotin_lipoyl
  • amino acids 70 to 142 (73 residues), 78.8 bits, E=1.1e-26

Best Hits

KEGG orthology group: K02160, acetyl-CoA carboxylase biotin carboxyl carrier protein (inferred from 100% identity to slo:Shew_3364)

Predicted SEED Role

"Biotin carboxyl carrier protein of acetyl-CoA carboxylase" in subsystem Fatty Acid Biosynthesis FASII

MetaCyc Pathways

• biotin-carboxyl carrier protein assembly (3/4 steps found)
• 3-hydroxypropanoate cycle (5/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (8/18 steps found)
• glyoxylate assimilation (4/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (5/18 steps found)

Sequence Analysis Tools

See A3QID2 at UniProt or InterPro

Protein Sequence (143 amino acids)

>Shew_3364 acetyl-CoA carboxylase, biotin carboxyl carrier protein (RefSeq) (Shewanella loihica PV-4)
MDIRKIKKLIELVQASDITELEIKEGEESIRLCRQPAVSASGQKAGVTIVNSPDAEAQTD
QEDYDEETLLRSPMVGTFYLAPAVDAAPLVKLGQRVEQGEPVCIIEAMKMMNQIQAPHAG
VVTALLCQSGDGVEFDQPLMVIE