Protein Info for Shew_3357 in Shewanella loihica PV-4

Annotation: RND family efflux transporter MFP subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF16576: HlyD_D23" amino acids 108 to 324 (217 residues), 104.6 bits, see alignment E=4.8e-34 PF13437: HlyD_3" amino acids 224 to 314 (91 residues), 48.8 bits, see alignment E=1.1e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3357)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIC5 at UniProt or InterPro

Protein Sequence (409 amino acids)

>Shew_3357 RND family efflux transporter MFP subunit (RefSeq) (Shewanella loihica PV-4)
MKNQSNKTRFLQLSPLMRAMGFGVLISMTAVGGVALGAEGHEHKAESAKGQVSQEQAHDK
EREQGDEAALGGEEAHGGELVLSEEQRQLAGIRVEQVSSQGFSLAAVATATLVVDRERTV
TLVPQLDVRVLARHVVPGQEVAKGQPLLTLGGAAVAQAQADYINAAAEWSRVKRMSQSAV
SASRRLQAQVDAELKRAILGALKMTPAQIKALESDPETIGSYQLLAPLDGRVQQDVAMKG
QVFSGGTALMQLTDESHLWVEAQVTPTQSQQIKVGSKALVKVGDFSLEAEVIGRSHEIDS
VTRTEQILVAFANPGHVLHAGQFAEIYLADNNQDGVILPDAALTRGGDGDWQVFVEEGDG
FEAVEVEVSERQRGMNLVQGLSPKMRVVVSGAFFLASEQAKSGFDIHNH