Protein Info for Shew_3343 in Shewanella loihica PV-4

Annotation: integral membrane sensor signal transduction histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details PF02518: HATPase_c" amino acids 309 to 412 (104 residues), 40.4 bits, see alignment E=1.8e-14

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 100% identity to slo:Shew_3343)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIB1 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Shew_3343 integral membrane sensor signal transduction histidine kinase (RefSeq) (Shewanella loihica PV-4)
MTTLSYGRYRAADQLALLRIMALMLKLCLTFLFADTFGLSLHSPALNLTLILEAFYLSFT
FWLRKPLLSSESGLFIALVLDTLLWISWLYFSGGATNAFISLLLLPIAIAAVLLPFWAPW
SLALLSNLAYSLMLFTMPESAMSHHGMDMQSHYLGMWVNFIISSLVLTTSVALLAKRMRR
QDAQLAFMREAQLRQEKLIALGTASAQMAHRLATPLASMRLLVDELQEEADGNGPALQEM
QSALTVCESTLTALRSATESIREGAQRLESAEQLLSGLSEQVNLLMPAVKLSLEPDDGLD
RLQLRVDASLQPALLALIENGARASQEATGEQKVSFSAQRQGDELVLGVRDFGPGIPASL
VQQLGHQIIEEPKGMGVALLLSHASLERLGGRLILGSHVDGGAVAQVYLPIQGAA