Protein Info for Shew_3342 in Shewanella loihica PV-4

Annotation: two component Fis family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 PF00072: Response_reg" amino acids 5 to 112 (108 residues), 69.3 bits, see alignment E=3.2e-23 PF02954: HTH_8" amino acids 133 to 171 (39 residues), 45.6 bits, see alignment 4.8e-16

Best Hits

Swiss-Prot: 43% identical to ACTR_RHIME: Acid tolerance regulatory protein ActR (actR) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K15012, two-component system, response regulator RegA (inferred from 100% identity to slo:Shew_3342)

Predicted SEED Role

"Dna binding response regulator PrrA (RegA)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIB0 at UniProt or InterPro

Protein Sequence (178 amino acids)

>Shew_3342 two component Fis family transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MKRLLIIEDEQSFAGILARRMGKHGFECELAHDATQALLKARQFKPSHILLDMKLAEDNG
LALIAPLKGAVPQAVLVLLTGYASIATAVEAMRLGADNYLTKPADTATLLRVLDDKAPKA
IAPEVDEAPLSPKRVEWEHLQQVLTANKGNVSATARQLGMHRRTLQRKLLKKPQDISQ