Protein Info for Shew_3333 in Shewanella loihica PV-4

Annotation: electron transport protein SCO1/SenC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF02630: SCO1-SenC" amino acids 39 to 153 (115 residues), 105.6 bits, see alignment E=2e-34 PF00578: AhpC-TSA" amino acids 41 to 123 (83 residues), 35.1 bits, see alignment E=1.2e-12

Best Hits

KEGG orthology group: K07152, (no description) (inferred from 100% identity to slo:Shew_3333)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIA1 at UniProt or InterPro

Protein Sequence (212 amino acids)

>Shew_3333 electron transport protein SCO1/SenC (RefSeq) (Shewanella loihica PV-4)
MTRVNQGKFHLALSLCVLLIGSLMSAASMANMPILKGIGGDFSLRSSKGGEVRLSDFHDK
VVMMFFGYTNCADICPTTMAHISQLMHQLPSETRDRIQVLFISIDSDYDTPKHLNKYLSY
FDPSFIGLVDEREKIDEVAALFKADYTKLAEEKVTTEYKKLSLEDSKAPKRQGYLYSHTA
KIFVLDGKQRVRGFFYTGTPIDEMRQQIESLL