Protein Info for Shew_3325 in Shewanella loihica PV-4

Annotation: major facilitator transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 269 to 286 (18 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details amino acids 357 to 374 (18 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 344 (327 residues), 112.2 bits, see alignment E=1.3e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3325)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QI93 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Shew_3325 major facilitator transporter (RefSeq) (Shewanella loihica PV-4)
MLDVADNCKSNNPTAPVIGLSFFAVASGFLMSLIPLSLGNFGLSPDLAPWLASIFYLGLL
LGALRVERLIAKMGHRRGFVLFLSLLIASIVAMLLLPGASVWLAARLLAGFTVAGVFVVV
ESWLLMADSVKARARRLGIYMAALYGGSALGQLAIGELGTQGVLPYLFVIVLLLLAIMAP
VLIRSGEPAHQAQQRLSLKESANLSRPAIIGCLVSGLLLGPIYGLMPVYIDNQVDEPAQT
GLLMAAIILGGMAVQPLISYLSPRMDKRLLMAMCTLVGLVGVIGAIESNAFMFKGLSYFI
LGAASFALYPIAISLACDKLPSTKIVSATEVMLLCYSLGSVAGPLLALSLSDKGHGMMIY
LAICLLSTCLYMLLKSLQKLDGQTDRLQS