Protein Info for Shew_3316 in Shewanella loihica PV-4

Annotation: magnesium transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 292 to 311 (20 residues), see Phobius details amino acids 317 to 344 (28 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details amino acids 392 to 418 (27 residues), see Phobius details amino acids 430 to 454 (25 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 22 to 453 (432 residues), 303.3 bits, see alignment E=1.4e-94 PF03448: MgtE_N" amino acids 39 to 138 (100 residues), 93.3 bits, see alignment E=2e-30 PF00571: CBS" amino acids 141 to 197 (57 residues), 21.3 bits, see alignment 4.1e-08 amino acids 204 to 260 (57 residues), 31.5 bits, see alignment 2.7e-11 PF01769: MgtE" amino acids 325 to 448 (124 residues), 109.9 bits, see alignment E=1.6e-35

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 100% identity to slo:Shew_3316)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QI84 at UniProt or InterPro

Protein Sequence (455 amino acids)

>Shew_3316 magnesium transporter (RefSeq) (Shewanella loihica PV-4)
MPIEVLDSETTDQRLNQLTQALGSGMFVHVRSMLHDMAASDIAFILESSPPRTRQVLWQL
IDQQHTGEILDELGEELKDTLITQMSPERVAKAAEGMDTDDLAYILRSLPDSVFNQVLQS
MTAQDRARVEQALSYPEDTAGSIMNTDTVTVRPDVTIDVILRYLRIRGELPDATDTLYVV
DKRDSLLGGVRITDLLTCDPNASVREIMNDDLEGIPVGMDDGEVAQLFERHDWVSAPVVE
EETNRLLGRITIDDIVDVIREDAEHSMMGMAGMDDDTDTFGPVVKSTLRRSLWLTINLFA
ALLAASVSNMFENTLEQFATIAILMTIVPSMGGVAGNQTLALVIRGIALGQIGQSNSRWL
IGKELAIGFLNGLLWSMLVFAAVWLWKGDIALGGLIGGAMLINMTVAGLAGACIPLLLKK
FNVDPALAGGMVLTTVTDVIGLFAFLGLATLFLLN