Protein Info for Shew_3314 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 PF03668: RapZ-like_N" amino acids 1 to 154 (154 residues), 156.2 bits, see alignment E=6.2e-50 PF22740: PapZ_C" amino acids 161 to 280 (120 residues), 165.2 bits, see alignment E=7.1e-53

Best Hits

Swiss-Prot: 100% identical to Y3314_SHELP: Nucleotide-binding protein Shew_3314 (Shew_3314) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K06958, UPF0042 nucleotide-binding protein (inferred from 100% identity to slo:Shew_3314)

Predicted SEED Role

"FIG000506: Predicted P-loop-containing kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QI82 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Shew_3314 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MKLVLVSGRSGSGKSVALRVLEDLGYYCVDNLPLQMMESLLEQLKGRSDLVAISVDVRNM
PSEEIQLEKQLAKLPKDTEILSFFLNSSDNVLLKRYSETRRLHPLSRSKVSLKEAIQLEG
KLLDPIAKLVDHYIDTSNLNIYELSDKVREILLGTVDKELVINFESFGFKYGMPTEADFM
FDVRFLPNPHWETELRPLTGLDEPVQQFLSQQPLVNKFIWQIENLLETWLPHLERNNRSY
LTIAIGCTGGQHRSVYVTDQLAKLFNKGKHKVQARHRELKHD