Protein Info for Shew_3313 in Shewanella loihica PV-4

Annotation: PTS IIA-like nitrogen-regulatory protein PtsN (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01419: PTS IIA-like nitrogen-regulatory protein PtsN
  • amino acids 3 to 146 (144 residues), 164.1 bits, E=9.3e-53
• PF00359: PTS_EIIA_2
  • amino acids 8 to 146 (139 residues), 124.1 bits, E=2.2e-40

Best Hits

Swiss-Prot: 58% identical to PTSN_KLEOX: Nitrogen regulatory protein (ptsN) from Klebsiella oxytoca

KEGG orthology group: K02806, PTS system, nitrogen regulatory IIA component [EC: 2.7.1.69] (inferred from 100% identity to slo:Shew_3313)

Predicted SEED Role

"PTS IIA-like nitrogen-regulatory protein PtsN"

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

See A3QI81 at UniProt or InterPro

Protein Sequence (147 amino acids)

>Shew_3313 PTS IIA-like nitrogen-regulatory protein PtsN (RefSeq) (Shewanella loihica PV-4)
MELSTILRPECTTCATPGSKKKVLELISDLAAVQYPTLSSQEIFESLLAREKMGSTGIGN
GIAIPHGRLTNIDQPVAVLVKCAEPIAFDAIDNQPVDILFALLVPADQCEQHLSTLAAMA
EKLNDKAIMKQLRKTQDESELYQVITQ