Protein Info for Shew_3274 in Shewanella loihica PV-4

Annotation: alcohol dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 TIGR02824: putative NAD(P)H quinone oxidoreductase, PIG3 family" amino acids 9 to 334 (326 residues), 421.4 bits, see alignment E=1.1e-130 PF08240: ADH_N" amino acids 34 to 116 (83 residues), 61.7 bits, see alignment E=1e-20 PF00107: ADH_zinc_N" amino acids 158 to 272 (115 residues), 74.6 bits, see alignment E=1.1e-24 PF13602: ADH_zinc_N_2" amino acids 190 to 332 (143 residues), 63.9 bits, see alignment E=4.6e-21

Best Hits

KEGG orthology group: K00344, NADPH2:quinone reductase [EC: 1.6.5.5] (inferred from 100% identity to slo:Shew_3274)

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QI42 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Shew_3274 alcohol dehydrogenase (RefSeq) (Shewanella loihica PV-4)
MSMLPTHYTHVQFNAPGGPEVLELAQSPLPEFAPDQLLIKVEYAGVNGPDIAQRRGLYPP
PPGASEILGLEVSGTVVAVGDAVTGWQLGDRVCALVPGGGYGEYVTTWGVHCLPIPTGVT
MAQAAALPETFFTVWGHMFMRGGLKAGETVLIHGGSGGIGSAAVTLAKQFAVKVLVTCGC
QEKIDYCLALGADHGFNYHDEDLLAQIKAVAPQGVDLVLDMASGDLIDLNLKALAIEGRL
VTIALQRGRRAEVDVALLMAKRICWTGATLRPQSVAAKQAIADGLREQVWPKFDTQEGCS
LVPHLYAEFALGDAAKAHALMESGQHRGKLVLKVAND