Protein Info for Shew_3259 in Shewanella loihica PV-4

Annotation: heavy metal sensor signal transduction histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details TIGR01386: heavy metal sensor kinase" amino acids 8 to 461 (454 residues), 464 bits, see alignment E=3e-143 PF21085: CusS" amino acids 8 to 163 (156 residues), 119.9 bits, see alignment E=2.3e-38 PF00672: HAMP" amino acids 188 to 238 (51 residues), 26.8 bits, see alignment 1.1e-09 PF00512: HisKA" amino acids 245 to 310 (66 residues), 55.1 bits, see alignment E=1.3e-18 PF02518: HATPase_c" amino acids 357 to 461 (105 residues), 83 bits, see alignment E=4.2e-27

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 100% identity to slo:Shew_3259)

Predicted SEED Role

"Signal transduction histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QI27 at UniProt or InterPro

Protein Sequence (462 amino acids)

>Shew_3259 heavy metal sensor signal transduction histidine kinase (RefSeq) (Shewanella loihica PV-4)
MFTRHPQISLKTRTLYLVGGTLLACFLLLGVMIDSQVKGHFLHQDEDELNVVADSVKGML
SSLSKPQDRHQIDNSLSQAVVGHHGIFYALYNNDNQLIYSNKDSDLSHFLLLDAKERVKA
SALVVVEVQEQHLRGALLGVTLPDGRSGKLVVANDIDFHLAFLSEFHRTLWSTLFLVWLL
TILAAWLAIRFGLRPLQRLSKEISGITTERLDLRLKPELAPIELSELIAAFNHMIGEVEL
GFKRLSHFSADIAHELRTPLTALAMQNEVLLSQSRSTEEYQELIYSNLEELERLTVMVND
MLWLAKSDNGLIEPKKQKIALDKEADKVIDYLSVLADEKNVSIVRDGSGEIYADNGMMQR
ALSNLIGNAVRHAEPGSEITVGIAQTPEATYVKVNNLGTPIPEQHVNHLFDRFYKVEAAR
QREGSSTGLGLAIVKSIADIHGGKVSARSRDGNTCFTLTLPK