Protein Info for Shew_3251 in Shewanella loihica PV-4

Annotation: UBA/THIF-type NAD/FAD binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 244 to 263 (20 residues), see Phobius details PF00899: ThiF" amino acids 20 to 184 (165 residues), 131.9 bits, see alignment E=1.1e-42

Best Hits

Swiss-Prot: 60% identical to TCDA_HAEIN: tRNA threonylcarbamoyladenosine dehydratase (tcdA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3251)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QI19 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Shew_3251 UBA/THIF-type NAD/FAD binding protein (RefSeq) (Shewanella loihica PV-4)
MSQPELSDAYLNRFAGIGRLYGAKALTRFAQSHVAVVGIGGVGTWVAEALARSGIGEITL
IDLDDICVTNTNRQLHALKETIGESKVAVMAERIMQINPECRVNQVEDFITTDNLNDYFT
GRKQGGSLDYVVDCIDAVKPKAALIAHCKRQKLPIVTVGGAGGQTDPTQIQVADLAKTYQ
DPLLAKVRNLLRREYNFSKNVQRRFSIEAVFSTEQLVYPQSDGSVCNVKATAEGSMRMDC
TSGFGAVTVVTGSFGFTAVSRVLTKLAAKA