Protein Info for Shew_3245 in Shewanella loihica PV-4

Annotation: polysulphide reductase, NrfD (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 6 to 32 (27 residues), see Phobius details amino acids 51 to 74 (24 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details PF03916: NrfD" amino acids 3 to 296 (294 residues), 103.1 bits, see alignment E=1.2e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3245)

Predicted SEED Role

"NrfD protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QI13 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Shew_3245 polysulphide reductase, NrfD (RefSeq) (Shewanella loihica PV-4)
MSEVHWGLLVAAYLFLAGAGAGALFISGALVLSEKVVHAHHWSTAKFSAIAGLLLLMLGT
GMIVFDLTSFQYGIFNGDMSKLLRFYRLFMTFEPSSMMSIGTWLLTLAIIFALLFCFSFK
RRNQETFTSRGYALINLILAICVASYTALLIGDIKHNIVWSNSILVVIFLVSAISSGAAV
VLIVKTWLKQSDPHHHFAKADSMVMLIELFVLGIFVYAIANVSKFYGLDNLLGMATSAGK
IWWLGAVVVGLLLPLLLNLTSIMGRVGVSHAKEYGIAALTLVGAFCLRYSVLLAGQSY