Protein Info for Shew_3233 in Shewanella loihica PV-4

Annotation: Crp/FNR family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00027: cNMP_binding" amino acids 64 to 145 (82 residues), 66 bits, see alignment E=3.6e-22 PF13545: HTH_Crp_2" amino acids 183 to 248 (66 residues), 59.6 bits, see alignment E=3.5e-20 PF00325: Crp" amino acids 201 to 232 (32 residues), 39.9 bits, see alignment 4.2e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3233)

Predicted SEED Role

"Fumarate and nitrate reduction regulatory protein" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QI01 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Shew_3233 Crp/FNR family transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MIKSISTGRTQQGYFSPVEKQMFGAALLADPDTSSPFSDVLSIAESGCSSSLLQQLTSVT
KRFRHLKPEQYLLRQQDQFDSLFVVKKGALKSYRLTPEGEEIVTGFYMEGDVIGAGGLGN
HKHFYSVVALEPSSLYEIPFAKLLQQSAMEPIVQQLMLKLLSQEMQADQSLRLIQLKQVK
AAIASLILNIANRLTATQITLPMSRVDIANLLGVASETVCREFTRLQKQGLLSVNRKHIV
INDLPQLQLAAGGDCY