Protein Info for Shew_3232 in Shewanella loihica PV-4

Annotation: peptidase M50 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 162 to 191 (30 residues), see Phobius details amino acids 203 to 220 (18 residues), see Phobius details amino acids 232 to 255 (24 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 320 to 338 (19 residues), see Phobius details amino acids 358 to 376 (19 residues), see Phobius details PF02163: Peptidase_M50" amino acids 180 to 253 (74 residues), 46.3 bits, see alignment E=1.8e-16 amino acids 261 to 295 (35 residues), 27.2 bits, see alignment 1.2e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3232)

Predicted SEED Role

"Zn-dependent protease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QI00 at UniProt or InterPro

Protein Sequence (392 amino acids)

>Shew_3232 peptidase M50 (RefSeq) (Shewanella loihica PV-4)
MSGLFSLPWLYRHNPRQIAVTDNGKHVELLRIDCLGKELRLEGSLAGWQQLFWDNQLVSV
KEACAENQGLRNHEFELSRHDPQQETVQKIPLTLEVDLIWQPFTLNYRLLSEDAVLSEGS
RNAKDIERQTPVTPVKAPQKLSLVGLASLGFKLLKSAKVIKVVLAGASVAAYSWLFSFQF
ALALIACLMFHEYGHIRAMKYFGMKTKGIYLIPFMGGLALSDEKINTRWQDVVISIMGPT
FGLLMSIAALVAYWITDNPLFAGLAAFNALLNLFNLLPILPLDGGHILKSISFSMNSLMG
LVACVAGAAIGVFISYSLGLALLGFLLLIGSLEIVFEWKSRHQSHLLPLDRYGQIFSTIW
YLLTVGALVAIIWYLAGSGDNMLGLPLKILQS