Protein Info for Shew_3230 in Shewanella loihica PV-4

Annotation: rRNA (guanine-N(2)-)-methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF08468: MTS_N" amino acids 6 to 164 (159 residues), 170 bits, see alignment E=1.6e-53 PF05175: MTS" amino acids 172 to 337 (166 residues), 200.8 bits, see alignment E=4.8e-63 PF06325: PrmA" amino acids 195 to 333 (139 residues), 31.2 bits, see alignment E=6.6e-11 PF13847: Methyltransf_31" amino acids 203 to 310 (108 residues), 30.4 bits, see alignment E=1.2e-10 PF13649: Methyltransf_25" amino acids 205 to 302 (98 residues), 35.7 bits, see alignment E=4.6e-12 PF08242: Methyltransf_12" amino acids 206 to 279 (74 residues), 32.3 bits, see alignment E=5.4e-11 PF08241: Methyltransf_11" amino acids 206 to 304 (99 residues), 24.8 bits, see alignment E=1.1e-08

Best Hits

Swiss-Prot: 100% identical to RSMC_SHELP: Ribosomal RNA small subunit methyltransferase C (rsmC) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 100% identity to slo:Shew_3230)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase C (EC 2.1.1.52)" (EC 2.1.1.52)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.172

Use Curated BLAST to search for 2.1.1.172 or 2.1.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHZ8 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Shew_3230 rRNA (guanine-N(2)-)-methyltransferase (RefSeq) (Shewanella loihica PV-4)
MLSNPSQVVLRNIELFESKNVLLINHECDLLATALLEDAAKVTTLALDFNHFQRIKSHEN
ARLQCHFGHQLPSTQTFDAVVLFYPKSKSLAPYLLNLAGRHLIPGGELVIVGEKKGGIRS
ITKQLPDYFDGGIKLDNARHCMLYSSSLLSEAPEIKLSDWVKDYVLSTPQGELTICNLVG
VFSEKRLDEGTELLLEHLPTLKGRVLDFGCGAGVITAALLKANPDLELECVDINAMALAS
CELTLAANGMQAKVYASDGLTQTQGMFDAIISNPPFHDGLDSTTEIATRFVQESEAQLKS
GGIFQIVANRHLPYSDTIAKFFKTVNVAAENNKYKIYANRKA