Protein Info for Shew_3209 in Shewanella loihica PV-4

Annotation: nitrate reductase cytochrome c-type subunit (NapB) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF03892: NapB" amino acids 31 to 138 (108 residues), 108.4 bits, see alignment E=2.7e-35

Best Hits

Swiss-Prot: 59% identical to NAPB_SHEON: Periplasmic nitrate reductase, electron transfer subunit (napB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02568, cytochrome c-type protein NapB (inferred from 100% identity to slo:Shew_3209)

Predicted SEED Role

"Nitrate reductase cytochrome c550-type subunit" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHX7 at UniProt or InterPro

Protein Sequence (140 amino acids)

>Shew_3209 nitrate reductase cytochrome c-type subunit (NapB) (RefSeq) (Shewanella loihica PV-4)
MKKVLTLVALMALGACSGQQSKPAAEPVNISSLGKGEITAVRAADEMPTYPKKGQAIERG
FVHQPPLIPHKADYQISIKKNGCMTCHSPEKAKRMKATEIHSSHILADSKLNYEYFNCTQ
CHVPQAENKQKLVENNFSNQ