Protein Info for Shew_3208 in Shewanella loihica PV-4

Name: napH
Annotation: quinol dehydrogenase membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 96 to 126 (31 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 178 to 201 (24 residues), see Phobius details TIGR02163: ferredoxin-type protein, NapH/MauN family" amino acids 36 to 288 (253 residues), 372.9 bits, see alignment E=4.1e-116 PF12801: Fer4_5" amino acids 96 to 140 (45 residues), 52.4 bits, see alignment 1.4e-17 amino acids 192 to 228 (37 residues), 30.1 bits, see alignment 1.4e-10 PF12837: Fer4_6" amino acids 232 to 253 (22 residues), 25.6 bits, see alignment (E = 2.9e-09) PF13237: Fer4_10" amino acids 234 to 280 (47 residues), 30.1 bits, see alignment 1.3e-10 PF12838: Fer4_7" amino acids 238 to 282 (45 residues), 27.3 bits, see alignment 1.4e-09

Best Hits

Swiss-Prot: 52% identical to NAPH_HAEIN: Ferredoxin-type protein NapH (napH) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02574, ferredoxin-type protein NapH (inferred from 100% identity to slo:Shew_3208)

MetaCyc: 50% identical to ferredoxin-type protein NapH (Escherichia coli K-12 substr. MG1655)
RXN-18584 [EC: 7.1.1.8]

Predicted SEED Role

"Polyferredoxin NapH (periplasmic nitrate reductase)" in subsystem Nitrate and nitrite ammonification

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.1.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHX6 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Shew_3208 quinol dehydrogenase membrane component (RefSeq) (Shewanella loihica PV-4)
MTNGMSNTKMKTPGAAQTRFAQAAIDELGWWRAHKFLFLRRASQLCVLLTFAIGPWMGLW
VLKGNLSSSELLGTIPLSDPLVTLQVLMTGHLPETALLVGALLIALFYLLAGGRVFCSWV
CPVNLVTDAASWLRRKLRLPRTAEMPRNLRYYLLALVLLLPLVTGITVWEWVNPVPILYR
ALLFGAGSGLWILAMIFLLDLFISERAWCGHLCPTGALFALLGKASPVKVSAVNASACDN
CMDCFEVCPERQVLKPALKGDNPMIVDSDCTQCGRCIDVCAQRVFQYQNRIALKAENNQ