Protein Info for Shew_3188 in Shewanella loihica PV-4

Annotation: aromatic amino acid permease (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 185 to 209 (25 residues), see Phobius details amino acids 225 to 249 (25 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 371 to 393 (23 residues), see Phobius details PF03222: Trp_Tyr_perm" amino acids 1 to 388 (388 residues), 318.3 bits, see alignment E=8.4e-99 PF01490: Aa_trans" amino acids 4 to 305 (302 residues), 45.2 bits, see alignment E=5.3e-16

Best Hits

KEGG orthology group: K03834, tyrosine-specific transport protein (inferred from 100% identity to slo:Shew_3188)

Predicted SEED Role

"Tyrosine-specific transport protein" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHV6 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Shew_3188 aromatic amino acid permease (RefSeq) (Shewanella loihica PV-4)
MLGSIAIVAGTAIGGGMLALPLATASLGTIPALLLLVAIWGVSIYTSLLMLEINLRAGVG
LNVHAITGKTLGKVGQLIQGGSFLSLLFALTMVYLMGGSSLLESRFEPLGIKVNHEAAVL
IFTLVFGGFIAIGVSWIDKVSRVLFSAMVALFVIVVLFLLPEVSPSYILRESATELVSKG
ELGNLWLAAIPVVFTSFGFHVCIATIVRYLDGDAMSLRKVLMIGSTIPLVCYILWLMVTL
GTVGGATVYGFEGSLPKLVSALQGIAHSDILRQCIDLFANLALITSFLGVTMSLFDYIAE
LTRARDNLLGRLQTWLITFVPPLLCALYYPDGFIKVLGFAALPLVVMIIFLPIAMALGQR
KQNLGGYQVSGGQFALAASALVGLVIIAAQLWVAL