Protein Info for Shew_3178 in Shewanella loihica PV-4

Annotation: Na+/H+ antiporter NhaC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 75 to 100 (26 residues), see Phobius details amino acids 122 to 151 (30 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 242 to 271 (30 residues), see Phobius details amino acids 292 to 317 (26 residues), see Phobius details amino acids 387 to 410 (24 residues), see Phobius details amino acids 420 to 439 (20 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 20 to 223 (204 residues), 55.8 bits, see alignment E=2.3e-19 amino acids 238 to 438 (201 residues), 23.4 bits, see alignment E=1.7e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3178)

Predicted SEED Role

"Methionine transporter MetT" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHU6 at UniProt or InterPro

Protein Sequence (443 amino acids)

>Shew_3178 Na+/H+ antiporter NhaC (RefSeq) (Shewanella loihica PV-4)
MTTPTQTTAPKASFIALLPLFLFLALFIGAGVYFQSQGVDFAFYQLPSVVAILPAIILAL
LISKEKLNQSIETFIGGIGHSNIIAMCLIYLLAGAFASVAKATGGVDATVALGLSLVPSN
LLLPGFFVIAAFIATAMGTSMGTIAAVAPIALGVAEEAQIDLALMAGAVISGALFGDNLS
IISDTTIAATRTQGCEMKDKFRENLIFAIPASLITLVVFTLAGQGQADVAPQQIDFLKVI
PYLTILVLAVAGLNVFVVLTVGILLAGITGFATLDYGLIQFGKDIYAGFSNMQEIFILSM
LVGGLAALMQQQGGLAFVSKQIEKLIVRFSSAKGEASTRASELGMAGIVALTNTCVANNT
VSIVVTGDIAKDLAEKHEVTPKRAASILDIFSCIIQGLIPYGAQALLIASTFSISPLQAV
AHAWYCMILAIVAIAIVVLRKRH