Protein Info for Shew_3170 in Shewanella loihica PV-4

Annotation: sodium/hydrogen exchanger (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 55 to 76 (22 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 220 to 237 (18 residues), see Phobius details amino acids 243 to 260 (18 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 297 to 322 (26 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 364 to 383 (20 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 14 to 388 (375 residues), 152.8 bits, see alignment E=6.1e-49

Best Hits

KEGG orthology group: K11105, cell volume regulation protein A (inferred from 100% identity to slo:Shew_3170)

Predicted SEED Role

"Na(+)/H(+) antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHT8 at UniProt or InterPro

Protein Sequence (396 amino acids)

>Shew_3170 sodium/hydrogen exchanger (RefSeq) (Shewanella loihica PV-4)
MSYQVILLGIAALIAVGILLHHPSKTLGLPSLLIFMGVGLSLGNGEFNFVYDNLTLTSTV
GAVALNMIVFVGGINTKTESIKLAYREGGVLATFGVLLTTLILGALLYPLTEWSLVICLL
FAAVVSSTDAAAVFSILESKKLKLKERTDTVLEFESATNDPVALVMVMILTGIALAPDAP
VSPWAIGQMLGLQIALGIGVAFVVARLAVWALNSIHLEEYGLIPVFVLASFVLAAYGSEL
AGGNILIASYVCGVVMGNGIRRGVEVTRHFFNSLSWLAQSLMFIILGLQIFPQTLFSVFF
LSLIPAALLMLVARPLAVQICYLPFRQASWKKRLFISSIGLKGATPIVFSLIPAAAGVEG
AVEMVHLVFFIVLFSILLQGAAIEPLAKRLGLNSDS