Protein Info for Shew_3165 in Shewanella loihica PV-4

Annotation: polar amino acid ABC transporter, inner membrane subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 24 to 24 (1 residues), see Phobius details amino acids 27 to 52 (26 residues), see Phobius details amino acids 64 to 89 (26 residues), see Phobius details amino acids 98 to 115 (18 residues), see Phobius details amino acids 158 to 175 (18 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 23 to 117 (95 residues), 82.6 bits, see alignment E=1.2e-27 PF00528: BPD_transp_1" amino acids 41 to 223 (183 residues), 89 bits, see alignment E=1.7e-29

Best Hits

Swiss-Prot: 34% identical to GLNP_ECOL6: Glutamine transport system permease protein GlnP (glnP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to slo:Shew_3165)

MetaCyc: 34% identical to L-glutamine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Amino acid transport system permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHT3 at UniProt or InterPro

Protein Sequence (226 amino acids)

>Shew_3165 polar amino acid ABC transporter, inner membrane subunit (RefSeq) (Shewanella loihica PV-4)
MLDAINSSLFTPIGEDGLIGIYLILNGLKVTLIVTLFAMILGAILGVATTLMKMSSRWYL
RWPANLYVGVIRGTPVVVQLVILYFIVLATWDVDKVSAAIIAFGLNSGAYISEIIRAGIQ
AVDKGQTEAARSLGLSQAVTMKEVILPQAIKNILPALGNEFIVLLKETAVIGFIGGVDLM
RSGEIIRSRTFEDSVPLFTCALIYLALTYSFTFMLSKFEKRLKQSD