Protein Info for Shew_3163 in Shewanella loihica PV-4

Annotation: diguanylate cyclase with PAS/PAC sensor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR00229: PAS domain S-box protein" amino acids 83 to 189 (107 residues), 51 bits, see alignment E=1.6e-17 PF08447: PAS_3" amino acids 90 to 176 (87 residues), 78.5 bits, see alignment E=3.8e-26 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 190 to 344 (155 residues), 102.7 bits, see alignment E=1.8e-33 PF00990: GGDEF" amino acids 193 to 341 (149 residues), 121.4 bits, see alignment E=3.4e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3163)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHT1 at UniProt or InterPro

Protein Sequence (355 amino acids)

>Shew_3163 diguanylate cyclase with PAS/PAC sensor (RefSeq) (Shewanella loihica PV-4)
MEPDEQPSNQLANTEPSAETSAEPTADISAEQTADLIAKLKAENAALKRENAKLTLLNDR
AEEKLFAALDGNRLCLWEQHLPSGNLTIFNMRWGELLGFSREELAAHVDSWKQNLHPEDK
EWVIKAFEDHVEGKSDYYQAVHRMIHKDGSVTWVSDRGRIVERKPDGTPLRMMGTHMDIT
QEKRYEQELSELAHCDPLTNLSNRKAITLAFEELYQRGRGSIFFIDLDGFKELNDKLGHK
FGDHLLVHVAHTLRGVIGTQAQIARLGGDEFLILHPSQDQTLLSERAQSLLDVYRQAIIL
EGTEVKLGLSIGIYCFTPSDDFASACEFADAAMYRVKAQGKHDYLFWQAEQAAEG