Protein Info for Shew_3157 in Shewanella loihica PV-4

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00037: Fer4" amino acids 47 to 63 (17 residues), 22 bits, see alignment (E = 6.2e-08) amino acids 126 to 146 (21 residues), 25.2 bits, see alignment (E = 5.8e-09) PF12800: Fer4_4" amino acids 51 to 64 (14 residues), 14.5 bits, see alignment (E = 2.2e-05) amino acids 130 to 145 (16 residues), 16.1 bits, see alignment (E = 6.4e-06) PF12838: Fer4_7" amino acids 53 to 115 (63 residues), 32 bits, see alignment E=7.5e-11 amino acids 98 to 146 (49 residues), 35.4 bits, see alignment 6.6e-12 PF13247: Fer4_11" amino acids 94 to 188 (95 residues), 85 bits, see alignment E=2e-27 PF13237: Fer4_10" amino acids 96 to 143 (48 residues), 34.8 bits, see alignment 7.1e-12 PF12837: Fer4_6" amino acids 124 to 146 (23 residues), 24.8 bits, see alignment (E = 8.8e-09)

Best Hits

Swiss-Prot: 65% identical to NRFC_HAEIN: Protein NrfC homolog (nrfC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K04014, formate-dependent nitrite reductase, Fe-S protein (inferred from 100% identity to slo:Shew_3157)

MetaCyc: 55% identical to polysulfide reductase beta subunit (Wolinella succinogenes)
RXN-8269 [EC: 1.12.98.4]

Predicted SEED Role

"NrfC protein" in subsystem Nitrate and nitrite ammonification

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.98.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHS5 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Shew_3157 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MQVSKRQFLKGVGALLAGVSVYGATRTPQADSLLQPEQESEIKYAMVHDENACIGCNACV
QACREVNHIPEGVTRVKIERKGPFGEYPDQSYRFSRVSCQHCEAAPCVRVCPTGAAYIDK
ETGIVAVNSDRCVGCQYCIAACPYQVRYIHPETRTADKCDFCQKSRLAQGLQPACVEACP
TKALTFGNLKDPESDLVKLLKRKPSYRAKVDLGTRPKLFHIQTIDGEIML