Protein Info for Shew_3135 in Shewanella loihica PV-4

Annotation: L-lactate permease (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 198 to 225 (28 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 263 to 280 (18 residues), see Phobius details amino acids 314 to 336 (23 residues), see Phobius details amino acids 359 to 380 (22 residues), see Phobius details amino acids 399 to 416 (18 residues), see Phobius details amino acids 428 to 474 (47 residues), see Phobius details amino acids 489 to 490 (2 residues), see Phobius details amino acids 493 to 516 (24 residues), see Phobius details amino acids 527 to 546 (20 residues), see Phobius details PF02652: Lactate_perm" amino acids 5 to 543 (539 residues), 342.9 bits, see alignment E=1.9e-106

Best Hits

KEGG orthology group: K03303, lactate transporter, LctP family (inferred from 100% identity to slo:Shew_3135)

Predicted SEED Role

"L-lactate permease" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHQ3 at UniProt or InterPro

Protein Sequence (547 amino acids)

>Shew_3135 L-lactate permease (RefSeq) (Shewanella loihica PV-4)
MTLLQLLASLTPVISVMLFLVLLKMPASRAMPISMVMTGLAAVFIWQMDTTILGASVVEG
LLSALTPLSIIFGAVFLLNTLKYSGAMDTIRAGFTNISGDARVQVIIICWLFGSFIEGSA
GFGTPAAIGAPLLVLLGVPPVAAAVVALIADSTSVSFGAIGLPVLFGMEQGLMQGGVSMA
ADQIAQHGTSFADYAQFIALHMITIDLVTGTLIPLVLVSVLTGFFGRNKSFKEGLAIWKF
ALFAGLAFTVPAWLINYFAGPEFPSVIGSLVGMALVIPVARKGLLLPKTPWNDFAENDNQ
TQAKVETKAQFSQVAAWTPYIIMAGLLVLSRTVAPLKAWLTSFNISWTNLLGTELKAGFA
TLYAPGAFFVLVCILGFVLFKMKSPAIKESITVSCKSMLPTIISLGASVPMVKIFLNSGT
NEAGLQSMPVALADMLAGSMGAIWAWMSPIVGIFGAFLSGSATFSNMMFSGLQYSVADNI
GMNHALVLALQGIGANAGNMMCVMNVVAAATVVGMAGRESEIIRKTMPVALGYALIAGTI
ATLWGGL