Protein Info for Shew_3131 in Shewanella loihica PV-4

Annotation: poly(A) polymerase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 TIGR01942: poly(A) polymerase" amino acids 51 to 478 (428 residues), 601.2 bits, see alignment E=5e-185 PF01743: PolyA_pol" amino acids 82 to 211 (130 residues), 120.4 bits, see alignment E=9.8e-39 PF12627: PolyA_pol_RNAbd" amino acids 238 to 299 (62 residues), 63.3 bits, see alignment E=2.1e-21 PF12626: PolyA_pol_arg_C" amino acids 356 to 471 (116 residues), 134.8 bits, see alignment E=2.3e-43

Best Hits

Swiss-Prot: 52% identical to PCNB_ECOL6: Poly(A) polymerase I (pcnB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00970, poly(A) polymerase [EC: 2.7.7.19] (inferred from 100% identity to slo:Shew_3131)

MetaCyc: 52% identical to poly(A) polymerase I (Escherichia coli K-12 substr. MG1655)
Polynucleotide adenylyltransferase. [EC: 2.7.7.19]

Predicted SEED Role

"Poly(A) polymerase (EC 2.7.7.19)" in subsystem Polyadenylation bacterial (EC 2.7.7.19)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHP9 at UniProt or InterPro

Protein Sequence (480 amino acids)

>Shew_3131 poly(A) polymerase (RefSeq) (Shewanella loihica PV-4)
MSYDSGLILTLTQDPSSRCPIFRRISQFCKQLFEDNQNTTETTPAGLSLEIVARKHHAIS
RQHISENAIKVLYRLHKSGFKAYLVGGGVRDILLGLEPKDFDVVTNATPEEIKKLFRNCR
LVGRRFRLAHIVFGRDVIEVATLRGHHVDSGEKISKVNAEGRLLRDNVYGTIDEDAERRD
FTVNALYYDISDFSIHSYGGGLQDLESRTLRLIGDPQKRYREDPVRMLRAVRFATKLGMS
IDKAAAQPISELAPLLKDIPAARMYEEVLKLFFAGQAQNNYVMMRDFGLFAPLFPLVDNL
LEEDPKGPSHKMVKAIMRNTDERVEQDKSVTPAFFYAAMLWYPLSQRADDIALESGLSQY
DAFYAAMGDVMEQQCRTISIPRRFSTPAKDIWQLQLRFERNQGTRAFKFIEHPKFRAAYD
LLLLRAEAEGGNLAKTAAWWKSFVEGSEEQRSVIARSTNKGSRSRNNRRRRSPKKTPKAE