Protein Info for Shew_3122 in Shewanella loihica PV-4

Annotation: PepSY-associated TM helix domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 27 to 27 (1 residues), see Phobius details transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details PF03929: PepSY_TM" amino acids 15 to 257 (243 residues), 46.4 bits, see alignment E=4.9e-16 PF16357: PepSY_TM_like_2" amino acids 178 to 263 (86 residues), 32.6 bits, see alignment E=8.5e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3122)

Predicted SEED Role

"PepSY-associated TM helix"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHP0 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Shew_3122 PepSY-associated TM helix domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MTNKPRHPHRKPLWQKLAKIFRPWHRRLGIASALLVVMVAVSGVLINHSNDFKLDTAHVH
QGWLLDHYGIKAPGQVAIYASEPLLATSDNLLWLKDKPVLEAQGPLLGALAYGEHYVAID
AQHLYLLDRDGALLEQQSRATGLPQDLRALALLHTGDAGQLWLNTASGSYLSDSDLIEWQ
EAKPLVALDWQTPLADASSEAISKELSLKARAMHLSWERVLLDLHSGRIVGLPGSLMMDL
VALCLIFMAISGLYLWQQAKPRKRKA