Protein Info for Shew_3114 in Shewanella loihica PV-4

Annotation: two component, sigma54 specific, Fis family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 PF00072: Response_reg" amino acids 7 to 118 (112 residues), 69.1 bits, see alignment E=9e-23 PF00158: Sigma54_activat" amino acids 157 to 317 (161 residues), 109.6 bits, see alignment E=3.4e-35 PF14532: Sigma54_activ_2" amino acids 164 to 322 (159 residues), 51.8 bits, see alignment E=2.7e-17 PF07728: AAA_5" amino acids 175 to 275 (101 residues), 25.8 bits, see alignment E=2.4e-09 PF02954: HTH_8" amino acids 419 to 458 (40 residues), 34.7 bits, see alignment 2.9e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3114)

Predicted SEED Role

"Sigma-54 dependent DNA-binding response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHN2 at UniProt or InterPro

Protein Sequence (462 amino acids)

>Shew_3114 two component, sigma54 specific, Fis family transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MKLARNILLVDDEASWLRTLAVTLNRLVPEAEIDTCVDSRQVLNRLQVGDYALVLLDLTM
PFHSGEELLGMIRAEHPNTRVIIVTGVNEVDTAVRCIKHGAYDYFIKTDNVSDLAHTVRR
ALEVVGLERNYLHIKERFLSRTLDNPKAFNNILTCEPVLLDQFRYLEAVAFSPEPLLIHG
ESGTGKSEFARSCHQLFSPEQPFVSLNLAGINSDTFELKLCGRLSHKPNGEVDAVTGMLH
QAGSGVLYLSEIGALPLSAQITLLELIESRSYSPQGSDSRFPIKCKFVVSTQDDLLTLNK
AGEFRSDLLYRLRAHKIRLPRLAERPLDIAMLINHFIAEAAEEMSLSAPQQPRDLAPKLL
DYDFPGNLNELKGMVFDAVSRSDGVTLNISPFMEAIKEHKSLDAAPGDHIIFPKSLPTLA
QMNQALIDEAMSRTANNQTAAAQILGISQSALSRRLTKGQEH