Protein Info for Shew_3091 in Shewanella loihica PV-4

Annotation: membrane-flanked domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 46 to 64 (19 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details PF03703: bPH_2" amino acids 97 to 172 (76 residues), 45.5 bits, see alignment E=3.7e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3091)

Predicted SEED Role

"membrane-flanked domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHK9 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Shew_3091 membrane-flanked domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MEDVTPQISASMQARRRLEQPDWIAIDEVPLTPLEQAYLHQVQIENLLIFTPLLIIAPLA
AILLNLPGSLIIALVTGILILAGIVSYCRYRYALSIAYGVFDHEFIMQKGLIWHKKIALP
YTRLQHVSLSQGPLERYFHQHTLKCFSAGSGSAEISLPGLGDDTAEPLRKHLLAKASQKQ
ASQKQAAQEQNSLKQASQNQAPDGRED