Protein Info for Shew_3088 in Shewanella loihica PV-4

Annotation: short chain fatty acid transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 96 to 123 (28 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 329 to 353 (25 residues), see Phobius details amino acids 390 to 408 (19 residues), see Phobius details amino acids 414 to 435 (22 residues), see Phobius details PF02667: SCFA_trans" amino acids 1 to 435 (435 residues), 514.9 bits, see alignment E=2.3e-158 PF03606: DcuC" amino acids 343 to 434 (92 residues), 24.2 bits, see alignment E=1.2e-09

Best Hits

KEGG orthology group: K02106, short-chain fatty acids transporter (inferred from 100% identity to slo:Shew_3088)

Predicted SEED Role

"Short chain fatty acids transporter" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHK6 at UniProt or InterPro

Protein Sequence (436 amino acids)

>Shew_3088 short chain fatty acid transporter (RefSeq) (Shewanella loihica PV-4)
MLNKAAKPLVKLVDRYLPDPYIFVLLLTLLVFVAAMMVEQQSPLQLVTYWGQGFWALLSF
SMQMLLVLVAGYMLASSPPIKRLLDSIAALAKSAPQAIILVTLVSLLASWINWGFGLVVG
ALFAKALARQVKVDYRLLVASAYSGFVVWHGGLAGSIPLTIATKGHFAEDKIGIIATDNT
IFAGFNLALVAVLFVLIPLVNRFMLPSDDESIYVDRDKLAEPEVETEAITRPADYLENSR
LLAWAVGGAGLVYLGQYFFAAGGKLNLNIVNYLFLFLAIILHQTPRSLLTSLNEAIKGGA
GIVIQFPFYAGIMALMVQSGLAQSISSGFVAIASADSLPFWSFISAGIVNIFVPSGGGQW
AVQAPIMLPAAEALGADVARVAMAVAWGDAWTNLIQPFWALPVLAIAGLKARDIMGFCLM
QLIITGIVISIGLTWF