Protein Info for Shew_3048 in Shewanella loihica PV-4

Annotation: alcohol dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF08240: ADH_N" amino acids 28 to 143 (116 residues), 94.9 bits, see alignment E=4.1e-31 PF01262: AlaDh_PNT_C" amino acids 176 to 254 (79 residues), 27.4 bits, see alignment E=3.3e-10 PF00107: ADH_zinc_N" amino acids 185 to 307 (123 residues), 68.6 bits, see alignment E=8.1e-23

Best Hits

Swiss-Prot: 49% identical to MTDH_MEDSA: Probable mannitol dehydrogenase (CAD1) from Medicago sativa

KEGG orthology group: K13979, uncharacterized zinc-type alcohol dehydrogenase-like protein [EC: 1.-.-.-] (inferred from 100% identity to slo:Shew_3048)

MetaCyc: 49% identical to 8-hydroxygeraniol dehydrogenase (Catharanthus roseus)
RXN-12961 [EC: 1.1.1.324]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 1.1.1.1

Use Curated BLAST to search for 1.-.-.- or 1.1.1.1 or 1.1.1.324

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHG6 at UniProt or InterPro

Protein Sequence (348 amino acids)

>Shew_3048 alcohol dehydrogenase (RefSeq) (Shewanella loihica PV-4)
MKTIGFAAESAHSPLQPYEYDCRPLREDDVAIEILYSGVCHSDLHTVNNDWGWTVFPTVP
GHEIVGRVVEVGSQVSRYKVGDQVAVGCMVDSCQSCSQCHSGEEQFCEAGFTQTYNSVDR
HTQAITKGGFAKHIVVRQEFVLSIPKSLDLAKAAPLLCAGITTYSPLRTWNVGPGSQVAI
IGMGGLGHMAIKLAVAMGAHVTVISRSQDKQGDALDLGANDFLLSSEPESMELSANRFDL
ILDTVPVKHDITPYLPLLKVDGTLTLVGQVGPIAEVNTVPMVMGRRRIAASLIGGIAQTQ
EMLDFCAKMNILPEVEMIKMEEINQAFERLERADVRYRFVIDMQASSF