Protein Info for Shew_3015 in Shewanella loihica PV-4

Annotation: gamma-glutamyl phosphate reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 PF00171: Aldedh" amino acids 7 to 285 (279 residues), 63.5 bits, see alignment E=7.4e-22 TIGR00407: glutamate-5-semialdehyde dehydrogenase" amino acids 11 to 404 (394 residues), 452.5 bits, see alignment E=5.8e-140

Best Hits

Swiss-Prot: 74% identical to PROA_SHEDO: Gamma-glutamyl phosphate reductase (proA) from Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)

KEGG orthology group: K00147, glutamate-5-semialdehyde dehydrogenase [EC: 1.2.1.41] (inferred from 100% identity to slo:Shew_3015)

Predicted SEED Role

"Gamma-glutamyl phosphate reductase (EC 1.2.1.41)" in subsystem Proline Synthesis (EC 1.2.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.41

Use Curated BLAST to search for 1.2.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHD3 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Shew_3015 gamma-glutamyl phosphate reductase (RefSeq) (Shewanella loihica PV-4)
MSIIETLSRDAAQAAKTLAQVDTQTKNTILLDMARSLRDNSFEIRSANLIDLASAEQAGL
SHAMIDRLTLDGDRIEAMAHGIEIIATLPDPIGVQRDLSTRPNGLAISKMRVPLGVVCMI
YEARPNVTADAGALCFKSGNAVILRGGKEALHTSKVIASVLQKVLKQYGLPASLIAVVPD
PDRALLMELMQQRDTIDVIIPRGGEGLINFVTEHSKVPVIQHFKGVCHLYVDKDADLDKA
LALLLNGKTQRTGVCNALEGLLVHSEVAPKFLAMAATALAKHQVKINCCANTQQYFAAAQ
VLSDEEFGQEYLDLELAVRQVKDFDQAVAHIHRFGSRHTEVICTENELTAKRFQRTVDAS
VVMVNASSRFSDGGELGLGAEIGIATTKLHAYGPMGLESLTTEKYLVNGDGQIRA