Protein Info for Shew_3013 in Shewanella loihica PV-4

Annotation: sodium/proline symporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 45 to 69 (25 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 315 to 337 (23 residues), see Phobius details amino acids 369 to 386 (18 residues), see Phobius details amino acids 392 to 413 (22 residues), see Phobius details amino acids 424 to 442 (19 residues), see Phobius details amino acids 454 to 474 (21 residues), see Phobius details TIGR02121: sodium/proline symporter" amino acids 5 to 491 (487 residues), 656.1 bits, see alignment E=3.2e-201 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 34 to 432 (399 residues), 289.7 bits, see alignment E=4.2e-90 PF00474: SSF" amino acids 34 to 432 (399 residues), 304.1 bits, see alignment E=7.9e-95

Best Hits

KEGG orthology group: K03307, solute:Na+ symporter, SSS family (inferred from 100% identity to slo:Shew_3013)

Predicted SEED Role

"Proline/sodium symporter PutP (TC 2.A.21.2.1) @ Propionate/sodium symporter" (TC 2.A.21.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHD1 at UniProt or InterPro

Protein Sequence (498 amino acids)

>Shew_3013 sodium/proline symporter (RefSeq) (Shewanella loihica PV-4)
MHYLTYISLAIYFLAMLAIGLFAYRRSTDDVSGYILGGRQVSPQVTALSAGASDMSGWML
MGLPGAMFLVGFETIYIALGLLLGALVNYLIVAPKLRVYTEVANNALTIPEFFAKRFHDP
SCNVRIISAAIIVIFFTLYTSAGLVAGGKLFESAFEVNYELGLVITLGVVVSYTLLGGFL
AVSLTDFVQGCIMFVALILVPVVAYQEFSNADKMMNFAYESIPHFGEAMQNVTLLGLISA
LSWGLGYFGQPHIIVRFMAIRSVSDIKTAKNIGMSWMTVTIIGALATGLVGIAYANKFDM
KLSDPETIFIVFSELLFHPLISGFLLAAILAAIMSTISSQLLVSSSSLTEDIYRVVSKKE
ASEEEMVKLGRFGVAGVAIVASLLALDRSNSILSLVSNAWAGFGAAFGPLVLFSLYKKNL
THKAAVAGIVAGAATVLFWIYAPVLPEGKALSSMLYEMIPGFMASSLVIWGVSALDGDPC
ENTIETFDEAGRQLAEQR