Protein Info for Shew_3006 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02589: LUD_dom
  • amino acids 89 to 189 (101 residues), 50.4 bits, E=1.2e-17

Best Hits

KEGG orthology group: K00782, hypothetical protein (inferred from 100% identity to slo:Shew_3006)

MetaCyc: 77% identical to L-lactate dehydrogenase LldF subunit (Shewanella oneidensis)
L-lactate dehydrogenase (cytochrome). [EC: 1.1.2.3]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, hypothetical protein subunit SO1518" in subsystem Lactate utilization

MetaCyc Pathways

• methylglyoxal degradation V (2/3 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (4/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.2.3

Sequence Analysis Tools

See A3QHC4 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Shew_3006 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MSSKQSILNALKSVAVAPQAMPPINVSPRLDDVIGQFETNLGTVAGTLHREGGLAALQTK
VDELIKEGKQVISQVEGVTGNRNAPDTAHELRDIDFAVIPGDVAVAENGAIWVNNQHLGH
RVTPFICENLFLVVSADKVVANMHQAIKQIGLDSGEFGVFIAGPSKTADIEQALVVGAHG
ACSLNVYLV