Protein Info for Shew_3005 in Shewanella loihica PV-4

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 PF02589: LUD_dom" amino acids 73 to 292 (220 residues), 152.1 bits, see alignment E=6.2e-48 PF13237: Fer4_10" amino acids 305 to 369 (65 residues), 31.8 bits, see alignment E=4.8e-11 PF13183: Fer4_8" amino acids 308 to 372 (65 residues), 52.4 bits, see alignment E=2.6e-17 PF13534: Fer4_17" amino acids 310 to 372 (63 residues), 33 bits, see alignment E=2.8e-11 PF12838: Fer4_7" amino acids 310 to 372 (63 residues), 34 bits, see alignment E=1.3e-11

Best Hits

Swiss-Prot: 42% identical to LUTB_ANOFW: Lactate utilization protein B (lutB) from Anoxybacillus flavithermus (strain DSM 21510 / WK1)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3005)

MetaCyc: 88% identical to L-lactate dehydrogenase iron-sulfur cluster-binding protein LldF (Shewanella oneidensis)
L-lactate dehydrogenase (cytochrome). [EC: 1.1.2.3]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHC3 at UniProt or InterPro

Protein Sequence (462 amino acids)

>Shew_3005 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MSSQTTALNSGVHAKKADIFCQDEARVDWHSKALWVLREKRDRAAASLPEWEQLRQLGSE
MKLHTLTHLGEYLETFEKNCQANGIVVHWAKDGAEHNQIVHNILAKHQVKKLVKSKSMLT
EECHLNPYLESKGIEVIDTDLGERIIQLAKQPPSHIVVPAIHLKKEEVGDLFHDKLGTEA
GASDPLYLTRAARAHLREQFLSADAAMTGVNMAIADKGAVVVCTNEGNADMGANLPKLQL
HSMGIDKIVPDLDSAAILLRTLARNATGQPITTYSSFYRGPQDGGEMHVIIVDNGRTDML
QDKILAESLKCIRCGGCLNTCPVYRRSGGYSYNYTIPGPIGIAVGAQADDTHSIPWACTL
CGSCSYVCPTKVPLDKIIHHHRRLKAKAGKLPYGKRNYMPLVGNFMASETMLNCSMSVAR
TALRILPGSLLKPFSGAWGKYRELPVAPKSSFEAWFNKNRGQ